HORDB

ID: hor004648
Uniprot ID: G7JV15
Protein name: CLAVATA3/ESR (CLE)-related protein 13
Gene name: CLE13
Organism: Medicago truncatula (Barrel medic) (Medicago tribuloides)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE13p]: Induced in roots during nodulation triggered by low nitrogen and infection with Sinorhizobium meliloti . |[CLE13p]: Expressed in young nodules throughout the central tissue .
Disease: NA
Comments: NA
Taxonomy: Medicago (genus), Trifolieae (tribe), IRL clade, Hologalegina, NPAAA clade, 50 kb inversion clade, Papilionoideae (subfamily), Fabaceae (family), Fabales (order), fabids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0030154 cell differentiation
GO CC: GO:0005576 extracellular region

Sequence: LRDHPLIHKNIDSRSLLQKLRIHISNHKQVRDISGDRLSPAGPDPQHNGRSPPRK
Length: 55
Propeptide: MGRYTTDQVQVYVLVIVLCTFFSTLQARSLRDHPLIHKNIDSRSLLQKLRIHISNHKQVRDISGDRLSPAGPDPQHNGRSPPRK
Signal peptide: MGRYTTDQVQVYVLVIVLCTFFSTLQARS
Modification: T40 Hydroxyproline;T43 Hydroxyproline
Glycosylation: T43 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Signaling peptide involved in the regulation of nodulation.
Mechanism: Moves from root to shoot to function with the receptor kinase SUNN, in a signaling pathway that plays roles during cellular differentiation, both at the onset of nodulation, and later during nodule meristem development and subsequent homeostasis. Interacts with SUNN signaling to control nodule numbers. SUNN is involved in the autoregulation of nodulation (AON), a long distance systemic signaling from root to shoot and back again, which allows legumes to limit the number of root nodules formed based on available nitrogen and previous rhizobial colonization (Probable).
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004648_AF2.pdb

hor004648_ESM.pdb

Mass:	726654	Formula:	C271H452N96O78
Absent amino acids:	CEFMTWY	Common amino acids:	RLPS
pI:	11.87	Basic residues:	16
Polar residues:	12	Hydrophobic residues:	13
Hydrophobicity:	-119.82	Boman Index:	-18769
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	85.09
Instability Index:	9961.82	Extinction Coefficient cystines:	0
Absorbance 280nm:	0